
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-OCSTAMP Antibody
상품 한눈에 보기
Human OCSTAMP 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. PrEST 항원으로 친화정제되었으며 IHC 등 연구용으로 적합합니다. Human에 반응하며, 40% glycerol 기반 완충액에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031116-100 Anti-OCSTAMP Antibody, osteoclast stimulatory transmembrane protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031116-25 Anti-OCSTAMP Antibody, osteoclast stimulatory transmembrane protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-OCSTAMP Antibody
Anti-OCSTAMP Antibody
Target Protein: Osteoclast stimulatory transmembrane protein (OCSTAMP)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human OCSTAMP.
Alternative Gene Names
- C20orf123
- dJ257E24.3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Osteoclast stimulatory transmembrane protein |
| Target Gene | OCSTAMP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000044581 (20%) Rat ENSRNOG00000011026 (20%) |
Antigen Information
Antigen Sequence (PrEST):
RLQRRHDRHQGQQLPLGDPSCVPTPRPACKPPAWIDYRLDALRTESSEGEGKELWSCRDLSCNLGPVPPPCVTLGKSLHLSEPRFLHLHNDSIFTIDVTYFPRRDVVRMEGNTGHD
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



