
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-OCIAD2 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody against human OCIAD2 단백질. IHC, WB, ICC 등 다양한 실험에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation으로 검증됨. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040979-100 Anti-OCIAD2 Antibody, OCIA domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040979-25 Anti-OCIAD2 Antibody, OCIA domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-OCIAD2 Antibody
Anti-OCIAD2 Antibody
OCIA domain containing 2
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human OCIAD2
Alternative Gene Names
- MGC45416
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | OCIA domain containing 2 |
| Target Gene | OCIAD2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GVCQSKFHFFEDQLRGAGFGPQHNRHCLLTCEECKIKHGLSEKGDSQPSAS |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Mouse Ortholog | ENSMUSG00000029153 (82%) |
| Rat Ortholog | ENSRNOG00000002196 (43%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



