CacheBy
Atlas Antibodies Anti-NXNL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NXNL1 Antibody

상품 한눈에 보기

Human NXNL1 단백질을 인식하는 토끼 폴리클로날 항체로, RDCVF/TXNL6 대체 유전자명으로도 알려진 nucleoredoxin-like 1 단백질 검출에 사용됩니다. IHC 등 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042010-100 Anti-NXNL1 Antibody, nucleoredoxin-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042010-25 Anti-NXNL1 Antibody, nucleoredoxin-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NXNL1 Antibody

Anti-NXNL1 Antibody

Target: nucleoredoxin-like 1 (NXNL1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human NXNL1.

Alternative Gene Names: RDCVF, TXNL6
Datasheet: Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nucleoredoxin-like 1
Target Gene NXNL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000042658 (76%), Mouse ENSMUSG00000034829 (74%)

Antigen Sequence:
PFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVE


Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.