CacheBy
Atlas Antibodies Anti-NWD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NWD2 Antibody

상품 한눈에 보기

Human NWD2 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity 정제됨. IHC 등 다양한 응용에 적합하며, 높은 종 간 보존성을 가짐. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046911-100 Anti-NWD2 Antibody, NACHT and WD repeat domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046911-25 Anti-NWD2 Antibody, NACHT and WD repeat domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NWD2 Antibody

Anti-NWD2 Antibody

Target: NACHT and WD repeat domain containing 2 (NWD2)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human NWD2 protein.
Alternative gene name: KIAA1239

Open Datasheet (PDF)


  • Immunohistochemistry (IHC)

Target Information

항목 내용
Target Protein NACHT and WD repeat domain containing 2
Target Gene NWD2
Alternative Gene Names KIAA1239
Verified Species Reactivity Human
Interspecies Identity Mouse (96%), Rat (94%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence DQPWVFQCNPLEPDIFFVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKELKFLANTLRSIKNKVTAFP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer Information

항목 내용
Composition 40% glycerol, PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.