CacheBy
Atlas Antibodies Anti-NUTF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUTF2 Antibody

상품 한눈에 보기

Human NUTF2 단백질을 인식하는 Rabbit Polyclonal 항체로, 핵 수송 인자 2 검출에 적합합니다. IHC 등 다양한 응용에 사용 가능하며, 고순도의 Affinity Purified 제품입니다. Human, Mouse, Rat에 반응합니다.

카탈로그번호
HPA040956-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040956-100 Anti-NUTF2 Antibody, nuclear transport factor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040956-25 Anti-NUTF2 Antibody, nuclear transport factor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUTF2 Antibody

Anti-NUTF2 Antibody

Target: Nuclear Transport Factor 2 (NUTF2)
Type: Polyclonal Antibody against Human NUTF2


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against human NUTF2 protein.


Alternative Gene Names

  • NTF2
  • PP15

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Nuclear Transport Factor 2
Target Gene NUTF2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Verified Species Reactivity Human
Ortholog Identity Mouse ENSMUSG00000008450 (100%)
Rat ENSRNOG00000018945 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.