CacheBy
Atlas Antibodies Anti-NVL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NVL Antibody

상품 한눈에 보기

Human NVL 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 Western Blot 실험에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human, Mouse, Rat 종에 반응합니다.

카탈로그번호
HPA028654-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028654-100 Anti-NVL Antibody, nuclear VCP-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028654-25 Anti-NVL Antibody, nuclear VCP-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NVL Antibody

Anti-NVL Antibody

Target Information

  • Target Protein: nuclear VCP-like
  • Target Gene: NVL
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    LESDMKRKGKLKNKGSKRKKEDLQEVDGEIEAVLQKKAKARGLEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLG
  • Verified Species Reactivity: Human, Mouse, Rat
  • Interspecies Information:
    • Mouse ENSMUSG00000026516 (84%)
    • Rat ENSRNOG00000003629 (78%)

Product Description

Polyclonal Antibody against Human NVL.

Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative added
Purification Method Affinity purified using PrEST antigen as affinity ligand
Applications IHC, WB
Verified Reactivity Human, Mouse, Rat

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.