CacheBy
Atlas Antibodies Anti-NUDT5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUDT5 Antibody

상품 한눈에 보기

Human NUDT5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human과 Rat에서 반응성이 검증되었습니다. 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA019827-100 Anti-NUDT5 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019827-25 Anti-NUDT5 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUDT5 Antibody

Anti-NUDT5 Antibody

Target: nudix (nucleoside diphosphate linked moiety X)-type motif 5
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NUDT5.


Alternative Gene Names

  • hYSAH1
  • YSA1H

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nudix (nucleoside diphosphate linked moiety X)-type motif 5
Target Gene NUDT5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Species Reactivity

  • Verified: Human, Rat
  • Interspecies Information:
    • Rat ENSRNOG00000017741 (90%)
    • Mouse ENSMUSG00000025817 (87%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.