
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NUDT4 Antibody
상품 한눈에 보기
Human NUDT4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(Orthogonal validation)에 적합합니다. 고순도 Affinity purification 방식으로 제조되었으며 Human, Mouse, Rat에 반응합니다. 연구용으로 최적화된 고품질 항체입니다.
- 카탈로그번호
- HPA017593-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA017593-100 Anti-NUDT4 Antibody, nudix hydrolase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017593-25 Anti-NUDT4 Antibody, nudix hydrolase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NUDT4 Antibody
Anti-NUDT4 Antibody
Target Protein: nudix hydrolase 4
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Orthogonal validation)
Orthogonal validation:
단백질 발현을 WB와 RNA-seq 데이터 비교를 통해 교차 검증(orthogonal validation)하였습니다.
Product Description
Polyclonal Antibody against Human NUDT4
Alternative Gene Names
DIPP2, DIPP2alpha, DIPP2beta, HDCMB47P, KIAA0487
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | nudix hydrolase 4 |
| Target Gene | NUDT4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Mouse ENSMUSG00000020029 (89%), Rat ENSRNOG00000009094 (89%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
| MSDS | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



