CacheBy
Atlas Antibodies Anti-NUDT4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUDT4 Antibody

상품 한눈에 보기

Human NUDT4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(Orthogonal validation)에 적합합니다. 고순도 Affinity purification 방식으로 제조되었으며 Human, Mouse, Rat에 반응합니다. 연구용으로 최적화된 고품질 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA017593-100 Anti-NUDT4 Antibody, nudix hydrolase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017593-25 Anti-NUDT4 Antibody, nudix hydrolase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUDT4 Antibody

Anti-NUDT4 Antibody

Target Protein: nudix hydrolase 4
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)

Orthogonal validation:
단백질 발현을 WB와 RNA-seq 데이터 비교를 통해 교차 검증(orthogonal validation)하였습니다.


Product Description

Polyclonal Antibody against Human NUDT4


Alternative Gene Names

DIPP2, DIPP2alpha, DIPP2beta, HDCMB47P, KIAA0487

Open Datasheet


Specifications

항목 내용
Target Protein nudix hydrolase 4
Target Gene NUDT4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Mouse ENSMUSG00000020029 (89%), Rat ENSRNOG00000009094 (89%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
MSDS Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.