AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NUDT16L1 Antibody
상품 한눈에 보기
Human NUDT16L1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 쥐와 생쥐와도 높은 서열 유사성을 가짐. 안정한 글리세롤 기반 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA044186-100 Anti-NUDT16L1 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044186-25 Anti-NUDT16L1 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NUDT16L1 Antibody
Anti-NUDT16L1 Antibody
Target: nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human NUDT16L1.
Alternative Gene Names
- SDOS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 |
| Target Gene | NUDT16L1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVL |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000003224 (96%)
- Mouse ENSMUSG00000022516 (96%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.