CacheBy
Atlas Antibodies Anti-NUDT16L1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUDT16L1 Antibody

상품 한눈에 보기

Human NUDT16L1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 쥐와 생쥐와도 높은 서열 유사성을 가짐. 안정한 글리세롤 기반 완충액에 보존제 포함.

카탈로그번호
HPA044186-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044186-100 Anti-NUDT16L1 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044186-25 Anti-NUDT16L1 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUDT16L1 Antibody

Anti-NUDT16L1 Antibody

Target: nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NUDT16L1.


Alternative Gene Names

  • SDOS

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1
Target Gene NUDT16L1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVL

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000003224 (96%)
  • Mouse ENSMUSG00000022516 (96%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.