Atlas Antibodies Anti-NUDT18 Antibody

상품 한눈에 보기

Human NUDT18 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현), ICC에 적합. PrEST 항원으로 친화 정제됨. 인간에 대해 검증되었으며, 마우스 및 랫과 91% 동일성 보유. 글리세롤 완충액에 보존제 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028581-100 Anti-NUDT18 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 18 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028581-25 Anti-NUDT18 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 18 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: nudix (nucleoside diphosphate linked moiety X)-type motif 18
Product Type: Polyclonal Antibody against Human NUDT18

IHC (Immunohistochemistry)
WB (Western Blot, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression.
ICC (Immunocytochemistry)

Polyclonal antibody raised in rabbit against human NUDT18, validated for use in IHC, WB, and ICC applications.

항목	내용
Target Protein	nudix (nucleoside diphosphate linked moiety X)-type motif 18
Target Gene	NUDT18
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	RLRKNVCYVVLAVFLSEQDEVLLIQEAKRECRGSWYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVFLAR
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000045211 (91%), Rat ENSRNOG00000011831 (91%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand