Atlas Antibodies Anti-NR4A1 Antibody

상품 한눈에 보기

Human NR4A1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. Orthogonal validation으로 검증되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 반응성이 확인되었고, NR4A1 관련 연구에 유용합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA059742-100 Anti-NR4A1 Antibody, nuclear receptor subfamily 4, group A, member 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA059742-25 Anti-NR4A1 Antibody, nuclear receptor subfamily 4, group A, member 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: nuclear receptor subfamily 4, group A, member 1 (NR4A1)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG

WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody against human NR4A1.

GFRP1, HMR, N10, NAK-1, NGFIB, NUR77, TR3

항목	내용
Target Protein	nuclear receptor subfamily 4, group A, member 1
Target Gene	NR4A1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000007607 (92%), Mouse ENSMUSG00000023034 (91%)

Antigen Sequence:
PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG

항목	내용
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage Note	Gently mix before use. Optimal concentrations and conditions should be determined by the user.