CacheBy
Atlas Antibodies Anti-NR2C1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NR2C1 Antibody

상품 한눈에 보기

Human NR2C1 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, Human에 대한 반응성이 검증됨. Glycerol 및 PBS buffer로 안정화되어 장기 보관 가능.

카탈로그번호
HPA067767-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067767-100 Anti-NR2C1 Antibody, nuclear receptor subfamily 2, group C, member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067767-25 Anti-NR2C1 Antibody, nuclear receptor subfamily 2, group C, member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NR2C1 Antibody

Anti-NR2C1 Antibody

Target: nuclear receptor subfamily 2, group C, member 1 (NR2C1)
Type: Polyclonal Antibody against Human NR2C1


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human NR2C1.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • TR2
  • TR2-11

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nuclear receptor subfamily 2, group C, member 1
Target Gene NR2C1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000005897 73%
Rat ENSRNOG00000006983 72%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.