CacheBy
Atlas Antibodies Anti-NR2C1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NR2C1 Antibody

상품 한눈에 보기

Human NR2C1 단백질을 인식하는 Rabbit Polyclonal 항체로, TR2/TR2-11로도 알려진 nuclear receptor subfamily 2, group C, member 1을 타깃함. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공하며, 인체 시료에 검증됨.

카탈로그번호
HPA035040-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035040-100 Anti-NR2C1 Antibody, nuclear receptor subfamily 2, group C, member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035040-25 Anti-NR2C1 Antibody, nuclear receptor subfamily 2, group C, member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NR2C1 Antibody

Anti-NR2C1 Antibody

Target: nuclear receptor subfamily 2, group C, member 1
Alternative Gene Names: TR2, TR2-11


ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against Human NR2C1.


Target Information

항목 내용
Target Protein nuclear receptor subfamily 2, group C, member 1
Target Gene NR2C1
Alternative Names TR2, TR2-11

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity with:

  • Mouse (ENSMUSG00000005897): 73%
  • Rat (ENSRNOG00000006983): 72%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.