CacheBy
Atlas Antibodies Anti-NR1H3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NR1H3 Antibody

상품 한눈에 보기

Human NR1H3 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. LXR-a, RLD-1 등 대체 유전자명으로도 알려짐. 40% 글리세롤 PBS 버퍼에 보존제 포함.

카탈로그번호
HPA036443-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036443-100 Anti-NR1H3 Antibody, nuclear receptor subfamily 1, group H, member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036443-25 Anti-NR1H3 Antibody, nuclear receptor subfamily 1, group H, member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NR1H3 Antibody

Anti-NR1H3 Antibody

Target: nuclear receptor subfamily 1, group H, member 3 (NR1H3)
Type: Polyclonal Antibody against Human NR1H3


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human NR1H3 protein.


Alternative Gene Names

  • LXR-a
  • RLD-1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nuclear receptor subfamily 1, group H, member 3
Target Gene NR1H3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRK
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000013172 (68%), Mouse ENSMUSG00000002108 (68%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.