Atlas Antibodies Anti-NQO1 Antibody

상품 한눈에 보기

Human NQO1 단백질을 표적으로 하는 고품질 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Human에 대한 높은 특이성과 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기

Atlas Antibodies HPA007308-100 Anti-NQO1 Antibody, NAD(P)H dehydrogenase, quinone 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007308-25 Anti-NQO1 Antibody, NAD(P)H dehydrogenase, quinone 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NQO1 Antibody

Anti-NQO1 Antibody

제품 개요

Target Protein: NAD(P)H dehydrogenase, quinone 1
Target Gene: NQO1
Product Type: Polyclonal Antibody against Human NQO1
Host: Rabbit
Isotype: IgG

대체 유전자명

DHQU, DIA4, DTD, NMOR1, QR1

권장 응용 분야

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

항원 정보

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR

종 특이성 검증

Verified Species Reactivity: Human
Interspecies Information:
- Mouse ENSMUSG00000003849 (88%)
- Rat ENSRNOG00000012772 (85%)

정제 및 보관 정보

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet