Atlas Antibodies Anti-NPY4R Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA027863-100 | - | Atlas Antibodies HPA027863-100 Anti-NPY4R Antibody, neuropeptide Y receptor Y4 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA027863-25 | - | Atlas Antibodies HPA027863-25 Anti-NPY4R Antibody, neuropeptide Y receptor Y4 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-NPY4R Antibody
neuropeptide Y receptor Y4
Recommended Applications
Product Description
Polyclonal Antibody against Human NPY4R
Alternative Gene Names
PP1, PPYR1, Y4
Target Protein
neuropeptide Y receptor Y4
Target Gene
NPY4R
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
NTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSPRLSGRSN
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000048337 (69%)
Rat ENSRNOG00000061026 (65%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|