Atlas Antibodies Anti-NONO Antibody

상품 한눈에 보기

Human NONO 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 검증을 통해 신뢰성 확보. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054559-100 Anti-NONO Antibody, non-POU domain containing, octamer-binding 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054559-25 Anti-NONO Antibody, non-POU domain containing, octamer-binding 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

non-POU domain containing, octamer-binding

IHC (Immunohistochemistry): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human NONO

NMT55, NRB54, P54, P54NRB, PPP1R114

항목	내용
Target Protein	non-POU domain containing, octamer-binding
Target Gene	NONO
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLG
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000031311 (99%) Rat ENSRNOG00000003689 (97%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand