CacheBy
Atlas Antibodies Anti-NONO Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NONO Antibody

상품 한눈에 보기

Human NONO 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 검증을 통해 신뢰성 확보. PrEST 항원을 이용해 친화 정제됨. 인간과 높은 종 간 반응성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA054094-100 Anti-NONO Antibody, non-POU domain containing, octamer-binding 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054094-25 Anti-NONO Antibody, non-POU domain containing, octamer-binding 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NONO Antibody

Anti-NONO Antibody

non-POU domain containing, octamer-binding


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human NONO


Alternative Gene Names

NMT55, NRB54, P54, P54NRB, PPP1R114

Open Datasheet


Target Information

항목 내용
Target Protein non-POU domain containing, octamer-binding
Target Gene NONO
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLG
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000031311 (99%), Rat ENSRNOG00000003689 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.