CacheBy
Atlas Antibodies Anti-BIN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BIN2 Antibody

상품 한눈에 보기

Human BIN2 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 및 Western Blot에 적합하며, RNA-seq 데이터 기반의 Orthogonal validation 완료. Affinity purification으로 높은 특이성과 재현성 제공.

카탈로그번호
HPA038666-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038666-100 Anti-BIN2 Antibody, bridging integrator 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038666-25 Anti-BIN2 Antibody, bridging integrator 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BIN2 Antibody

Anti-BIN2 Antibody

Target: bridging integrator 2 (BIN2)
Type: Polyclonal Antibody against Human BIN2

  • Orthogonal validation: Protein expression verified using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human BIN2 protein.

Alternative Gene Names

  • BRAP-1

Open Datasheet (PDF)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    EKPVRTPEAKENENIHNQNPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISADSSEGQDQLQVSMVPENNNLTAPEPQEEVSTSENPQL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000029366 31%
Mouse ENSMUSG00000028456 29%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.