AI 생성

1 / 2

Atlas Antibodies Anti-BIN1 Antibody

상품 한눈에 보기

Human BIN1 단백질을 인식하는 고품질 다클론 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정합 검증 완료. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA005437-100 Anti-BIN1 Antibody, bridging integrator 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA005437-25 Anti-BIN1 Antibody, bridging integrator 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Bridging Integrator 1 (BIN1)
Supplier: Atlas Antibodies

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Orthogonal Validation: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC: Suitable for immunocytochemistry.

Polyclonal antibody against human BIN1.

AMPH2, AMPHL, SH3P9

항목	내용
Target Protein	Bridging integrator 1
Target Gene	BIN1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (94%), Rat (93%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand

SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.