CacheBy
Atlas Antibodies Anti-BIN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BIN1 Antibody

상품 한눈에 보기

Human BIN1 단백질을 인식하는 고품질 다클론 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정합 검증 완료. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA005437-100 Anti-BIN1 Antibody, bridging integrator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005437-25 Anti-BIN1 Antibody, bridging integrator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BIN1 Antibody

Anti-BIN1 Antibody

Target: Bridging Integrator 1 (BIN1)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Orthogonal Validation: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC: Suitable for immunocytochemistry.

Product Description

Polyclonal antibody against human BIN1.


Alternative Gene Names

AMPH2, AMPHL, SH3P9


Target Information

항목 내용
Target Protein Bridging integrator 1
Target Gene BIN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (94%), Rat (93%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Antigen Sequence

SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.