CacheBy
Atlas Antibodies Anti-BCAR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BCAR1 Antibody

상품 한눈에 보기

인체 BCAR1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 고순도 PrEST 항원으로 정제되었으며, 사람과 생쥐에서 반응성이 검증되었습니다. 에스트로겐 저항성 유방암 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042282-100 Anti-BCAR1 Antibody, breast cancer anti-estrogen resistance 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042282-25 Anti-BCAR1 Antibody, breast cancer anti-estrogen resistance 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BCAR1 Antibody

Anti-BCAR1 Antibody

Target: breast cancer anti-estrogen resistance 1 (BCAR1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human BCAR1, also known as breast cancer anti-estrogen resistance 1.


Alternative Gene Names

CAS, CASS1, Crkas, P130Cas

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    SPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYD

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000019253 93%
Mouse ENSMUSG00000031955 93%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.