AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BCAP29 Antibody
상품 한눈에 보기
인간 BCAP29 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 데이터 기반 정교한 직교 검증이 수행되었습니다. 인간 반응성이 확인된 고품질 연구용 항체입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049694-100 Anti-BCAP29 Antibody, B-cell receptor-associated protein 29 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049694-25 Anti-BCAP29 Antibody, B-cell receptor-associated protein 29 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BCAP29 Antibody
Anti-BCAP29 Antibody
B-cell receptor-associated protein 29
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human BCAP29.
Alternative Gene Names
BAP29, DKFZp686M2086
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | B-cell receptor-associated protein 29 |
| Target Gene | BCAP29 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007884 (76%), Mouse ENSMUSG00000020650 (76%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.