CacheBy
Atlas Antibodies Anti-B3GAT3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-B3GAT3 Antibody

상품 한눈에 보기

Human B3GAT3 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합. GlcAT-I로도 알려진 beta-1,3-glucuronyltransferase 3 인식. Affinity purification으로 높은 특이성과 안정성 제공. Human에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051328-100 Anti-B3GAT3 Antibody, beta-1,3-glucuronyltransferase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051328-25 Anti-B3GAT3 Antibody, beta-1,3-glucuronyltransferase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-B3GAT3 Antibody

Anti-B3GAT3 Antibody

Target Protein: beta-1,3-glucuronyltransferase 3
Alternative Gene Name: GlcAT-I

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human B3GAT3.

Open Datasheet

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000071649 95%
Rat ENSRNOG00000019804 94%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.