CacheBy
Atlas Antibodies Anti-B3GAT2 Antibody
원본

Atlas Antibodies Anti-B3GAT2 Antibody

상품 한눈에 보기

Human B3GAT2 단백질을 인식하는 Rabbit Polyclonal 항체로, beta-1,3-glucuronyltransferase 2 검출에 사용됩니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 반응하며 Mouse, Rat과 높은 상동성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012059-100 Anti-B3GAT2 Antibody, beta-1,3-glucuronyltransferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012059-25 Anti-B3GAT2 Antibody, beta-1,3-glucuronyltransferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-B3GAT2 Antibody

Anti-B3GAT2 Antibody

Target Protein: beta-1,3-glucuronyltransferase 2
Product Type: Polyclonal Antibody against Human B3GAT2

Alternative Gene Names

  • GlcAT-S

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Product Description

이 항체는 Human B3GAT2 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원을 이용하여 친화 정제되었습니다.

Target Information

항목 내용
Target Protein beta-1,3-glucuronyltransferase 2
Target Gene B3GAT2
Alternative Gene Name GlcAT-S
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000026156 (96%), Rat ENSRNOG00000046852 (96%)

Antigen Sequence

PVGLVGGRRYERPLVENGKVVGWYTGWRADRPFAIDMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKANNCTKVLVWHTRTEKVNLANEPKYHLDTVK

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 맞는 최적 농도 및 조건은 사용자가 직접 설정해야 합니다.

Reference

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.