
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ATP6V0D1 Antibody
상품 한눈에 보기
Human ATP6V0D1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 발현 검증 완료. 고순도 Affinity 정제 제품으로 안정적인 PBS/glycerol buffer에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA016938-100 Anti-ATP6V0D1 Antibody, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016938-25 Anti-ATP6V0D1 Antibody, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ATP6V0D1 Antibody
Anti-ATP6V0D1 Antibody
ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression validated)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human ATP6V0D1
Alternative Gene Names
ATP6D, ATP6DV, P39, VATX, Vma6, VPATPD
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 |
| Target Gene | ATP6V0D1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKL |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000013160 (100%)
- Rat ENSRNOG00000017235 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



