
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ATP6V0A4 Antibody
상품 한눈에 보기
Human ATP6V0A4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. ATPase V0 subunit a4의 발현 연구에 적합하며, PrEST 항원으로 정제됨. Human에 특이적 반응성을 보이며 RNA-seq 데이터 기반 검증 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018029-100 Anti-ATP6V0A4 Antibody, ATPase, H+ transporting, lysosomal V0 subunit a4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018029-25 Anti-ATP6V0A4 Antibody, ATPase, H+ transporting, lysosomal V0 subunit a4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ATP6V0A4 Antibody
Anti-ATP6V0A4 Antibody
ATPase, H+ transporting, lysosomal V0 subunit a4
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ATP6V0A4
Alternative Gene Names
a4, ATP6N1B, ATP6N2, RDRTA2, RTA1C, RTADR, Stv1, Vph1, VPP2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ATPase, H+ transporting, lysosomal V0 subunit a4 |
| Target Gene | ATP6V0A4 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | RASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVFVHQAIHTIEYCLGCISNTAS |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000038600 | 65% |
| Rat | ENSRNOG00000013428 | 60% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



