CacheBy
Atlas Antibodies Anti-ATP6V0A4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATP6V0A4 Antibody

상품 한눈에 보기

Human ATP6V0A4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. ATPase V0 subunit a4의 발현 연구에 적합하며, PrEST 항원으로 정제됨. Human에 특이적 반응성을 보이며 RNA-seq 데이터 기반 검증 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018029-100 Anti-ATP6V0A4 Antibody, ATPase, H+ transporting, lysosomal V0 subunit a4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018029-25 Anti-ATP6V0A4 Antibody, ATPase, H+ transporting, lysosomal V0 subunit a4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATP6V0A4 Antibody

Anti-ATP6V0A4 Antibody

ATPase, H+ transporting, lysosomal V0 subunit a4


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human ATP6V0A4


Alternative Gene Names

a4, ATP6N1B, ATP6N2, RDRTA2, RTA1C, RTADR, Stv1, Vph1, VPP2

Open Datasheet


Target Information

항목 내용
Target Protein ATPase, H+ transporting, lysosomal V0 subunit a4
Target Gene ATP6V0A4
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence RASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVFVHQAIHTIEYCLGCISNTAS

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 유사도
Mouse ENSMUSG00000038600 65%
Rat ENSRNOG00000013428 60%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.