
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ASPH Antibody
상품 한눈에 보기
Human ASPH 단백질을 인식하는 Rabbit Polyclonal 항체로, aspartate beta-hydroxylase 연구용에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, Human에 대한 반응성이 검증됨. 40% glycerol 기반 안정화 버퍼 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055161-100 Anti-ASPH Antibody, aspartate beta-hydroxylase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055161-25 Anti-ASPH Antibody, aspartate beta-hydroxylase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ASPH Antibody
Anti-ASPH Antibody
Target: Aspartate beta-hydroxylase (ASPH)
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ASPH.
Alternative Gene Names
BAH, CASQ2BP1, HAAH, JCTN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Aspartate beta-hydroxylase |
| Target Gene | ASPH |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (99%), Rat (99%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
ESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDE
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



