CacheBy
Atlas Antibodies Anti-ASPG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ASPG Antibody

상품 한눈에 보기

Human ASPG 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Rabbit host에서 제작되었으며, PrEST 항원으로 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069761-100 Anti-ASPG Antibody, asparaginase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069761-25 Anti-ASPG Antibody, asparaginase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ASPG Antibody

Anti-ASPG Antibody

제품 개요

  • Target Protein: asparaginase
  • Target Gene: ASPG
  • Alternative Gene Names: C14orf76
  • Product Type: Polyclonal Antibody against Human ASPG

권장 응용 분야

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Antigen 정보

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000012843 80%
Mouse ENSMUSG00000037686 80%

항체 특성

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

참고 사항

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 적합한 최적의 농도와 조건은 사용자가 결정해야 합니다.

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.