원본
Thermo Fisher Scientific CXCL12 Polyclonal Antibody
상품 한눈에 보기
CXCL12 단백질을 인식하는 Rabbit Polyclonal Antibody. Western blot, IHC, IP 등 다양한 응용에 적합. Mouse와 Rat 시료에 반응하며, Protein A로 정제된 고순도 항체. 연구용으로만 사용 가능.
- 카탈로그번호
- PA129029
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 26. 오후 07:16
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA129029 CXCL12 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
721,400원VAT 포함 793,540원
Thermo Fisher Scientific · Thermo Fisher Scientific CXCL12 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:1,000 | View 1 publication |
| Immunohistochemistry (IHC) | 1:100–1:500 | - |
| Immunoprecipitation (IP) | 1:300–1:500 | - |
| In vitro Assay (IV) | - | View 1 publication |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse, Rat |
| Published Species | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein generated using E. coli-expressed mouse SDF-1α (aa 20–89). Sequence: DGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein A |
| Storage Buffer | PBS, pH 7.2 |
| Contains | 0.1% sodium azide |
| Storage Conditions | Store at 4°C (short term). For long-term, store at -20°C. Avoid freeze/thaw cycles. |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2276940 |
Product Specific Information
PA1-29029 detects CXCL12 from rat and mouse samples.
Target Information
CXCL12 is a stromal cell-derived alpha chemokine and a member of the intercrine family. Together with its receptor CXCR4, it can activate lymphocytes and is implicated in cancer metastasis, such as breast cancer. Mutations in this gene are associated with resistance to HIV-1 infection. Multiple transcript variants encoding different isoforms have been identified.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific MIP-3 alpha Polyclonal Antibody630,500원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CCL21 Polyclonal Antibody706,800원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CCL4 Polyclonal Antibody630,500원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TGF beta-1 Polyclonal Antibody640,300원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.