Atlas Antibodies Anti-NNT Antibody

상품 한눈에 보기

인간 NNT 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터와의 정합을 통한 정교한 Orthogonal 검증 수행. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 글리세롤 기반 완충액에 보존 처리.

카탈로그번호: HPA004829-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004829-100 Anti-NNT Antibody, nicotinamide nucleotide transhydrogenase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004829-25 Anti-NNT Antibody, nicotinamide nucleotide transhydrogenase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NNT Antibody

Anti-NNT Antibody

Target: nicotinamide nucleotide transhydrogenase (NNT)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against human NNT.

Open Datasheet (PDF)

Antigen Information

Target Protein: nicotinamide nucleotide transhydrogenase
Target Gene: NNT
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
ANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGT

Species Reactivity

Species	Reactivity	Identity (%)
Human	Verified	-
Rat (ENSRNOG00000026842)	Predicted	87
Mouse (ENSMUSG00000025453)	Predicted	86

Antibody Properties

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet