CacheBy
Atlas Antibodies Anti-NMT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NMT1 Antibody

상품 한눈에 보기

Human NMT1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 대해 검증된 반응성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA022963-100 Anti-NMT1 Antibody, N-myristoyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022963-25 Anti-NMT1 Antibody, N-myristoyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NMT1 Antibody

Anti-NMT1 Antibody

Target: N-myristoyltransferase 1 (NMT1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Independent validation by comparing antibodies targeting different epitopes
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human NMT1.


Alternative Gene Names

  • NMT

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein N-myristoyltransferase 1
Target Gene NMT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (AA) MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAK
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000002989 (91%), Mouse ENSMUSG00000020936 (91%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.