
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NFKB1 Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-NFKB1 항체는 인간 NFKB1 단백질을 표적으로 하는 고품질 폴리클로날 항체입니다. IHC 및 WB에서 유전자 및 단백질 수준 검증 완료. Rabbit 유래 IgG로, PrEST 항원을 이용해 친화 정제되었습니다. 다양한 조직 연구에 적합합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA027305-100 Anti-NFKB1 Antibody, nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027305-25 Anti-NFKB1 Antibody, nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NFKB1 Antibody
Anti-NFKB1 Antibody
Target: nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 (NFKB1)
Type: Polyclonal Antibody
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Genetic validation): Genetic validation in WB by siRNA knockdown.
- ICC: Verified for immunocytochemistry applications.
Product Description
Polyclonal antibody against human NFKB1.
Alternative Gene Names: KBF1, NF-kappaB, NF-kB1, NFkappaB, NFKB-p50, p105, p50
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 |
| Target Gene | NFKB1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000023258 (62%), Mouse ENSMUSG00000028163 (60%) |
Antigen Sequence:
GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



