CacheBy
Atlas Antibodies Anti-NFIA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NFIA Antibody

상품 한눈에 보기

Human NFIA 단백질을 표적으로 하는 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립적 및 직교적 검증으로 높은 신뢰성 확보. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

카탈로그번호
HPA006111-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006111-100 Anti-NFIA Antibody, nuclear factor I/A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006111-25 Anti-NFIA Antibody, nuclear factor I/A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NFIA Antibody

Anti-NFIA Antibody

Target: nuclear factor I/A (NFIA)
Type: Polyclonal Antibody against Human NFIA


  • IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Orthogonal validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody raised in rabbit against Human NFIA.

Alternative Gene Names: KIAA1439, NFI-L
Open Datasheet


Target Information

항목 내용
Target Protein nuclear factor I/A
Target Gene NFIA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQ

Species Reactivity

반응성
Human Verified
Mouse Verified
Rat Verified

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000006966 (100%)
  • Mouse ENSMUSG00000028565 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Orthogonal Validation
ICC Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.