
Atlas Antibodies Anti-NFIA Antibody
상품 한눈에 보기
Human NFIA 단백질을 표적으로 하는 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립적 및 직교적 검증으로 높은 신뢰성 확보. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NFIA Antibody
Target: nuclear factor I/A (NFIA)
Type: Polyclonal Antibody against Human NFIA
Recommended Applications
- IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Orthogonal validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody raised in rabbit against Human NFIA.
Alternative Gene Names: KIAA1439, NFI-L
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nuclear factor I/A |
| Target Gene | NFIA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQ |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | Verified |
| Rat | Verified |
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000006966 (100%)
- Mouse ENSMUSG00000028565 (98%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




