CacheBy
Atlas Antibodies Anti-NEDD9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEDD9 Antibody

상품 한눈에 보기

Human NEDD9 단백질을 표적하는 폴리클로날 항체로, Rabbit에서 생산됨. WB 및 ICC 응용에 적합하며, PrEST 항원으로 특이적 정제됨. 인간에 대한 검증된 반응성과 높은 종간 서열 일치율을 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009689-100 Anti-NEDD9 Antibody, neural precursor cell expressed, developmentally down-regulated 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009689-25 Anti-NEDD9 Antibody, neural precursor cell expressed, developmentally down-regulated 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEDD9 Antibody

Anti-NEDD9 Antibody

neural precursor cell expressed, developmentally down-regulated 9

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NEDD9.

Alternative Gene Names

CAS-L, CASS2, HEF1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein neural precursor cell expressed, developmentally down-regulated 9
Target Gene NEDD9
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014548 (90%), Mouse ENSMUSG00000021365 (89%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPS

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.