Atlas Antibodies Anti-NECTIN4 Antibody

상품 한눈에 보기

Human NECTIN4 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 제품입니다. Rabbit 유래 IgG 항체이며, PrEST 항원 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA010775-100 Anti-NECTIN4 Antibody, nectin cell adhesion molecule 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA010775-25 Anti-NECTIN4 Antibody, nectin cell adhesion molecule 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NECTIN4 Antibody

Anti-NECTIN4 Antibody

Target: nectin cell adhesion molecule 4
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC) – Orthogonal validation using RNA-seq data comparison in high and low expression tissues
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human NECTIN4.

Alternative Gene Names

LNIR, nectin-4, PRR4, PVRL4

Open Datasheet

Target Information

항목	내용
Target Protein	nectin cell adhesion molecule 4
Target Gene	NECTIN4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000006411 (90%), Rat ENSRNOG00000004029 (90%)

Antigen Sequence:
KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using PrEST antigen as affinity ligand