CacheBy
Atlas Antibodies Anti-NCKAP5L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCKAP5L Antibody

상품 한눈에 보기

인간 NCKAP5L 단백질을 인식하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 토끼에서 생산된 IgG 형식의 항체로, PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증되어 신뢰성 높은 연구용 시약.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041034-100 Anti-NCKAP5L Antibody, NCK-associated protein 5-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041034-25 Anti-NCKAP5L Antibody, NCK-associated protein 5-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCKAP5L Antibody

Anti-NCKAP5L Antibody

NCK-associated protein 5-like

  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human NCKAP5L.

Alternative Gene Names

  • KIAA1602

Open Datasheet

Target Information

항목 내용
Target Protein NCK-associated protein 5-like
Target Gene NCKAP5L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EEKVMKGIEENVLRLQGQERAPGAEVKHRNTSSIASWFGLKKSKLPALNRRTEATKNKEGAGGGSPLRREVKMEARKL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000023009 (92%), Rat ENSRNOG00000056678 (90%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.