CacheBy
Atlas Antibodies Anti-NCKAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCKAP1 Antibody

상품 한눈에 보기

인간 NCKAP1 단백질에 특이적인 폴리클로날 항체로, IHC 및 ICC 등 단백질 발현 분석에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. RNA-seq 데이터와의 정합을 통한 직교 검증으로 신뢰성이 높습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020449-100 Anti-NCKAP1 Antibody, NCK-associated protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020449-25 Anti-NCKAP1 Antibody, NCK-associated protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCKAP1 Antibody

Anti-NCKAP1 Antibody

NCK-associated protein 1


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC).

Product Description

Polyclonal antibody against human NCKAP1.


Alternative Gene Names

HEM2, Nap1, NAP125

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein NCK-associated protein 1
Target Gene NCKAP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEY
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000007518 (100%), Mouse ENSMUSG00000027002 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.