AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NCKAP1L Antibody
상품 한눈에 보기
Human NCKAP1L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합. PrEST 항원을 이용해 친화 정제됨. HEM1 유전자 대체명으로 알려짐. 인간에 대해 검증되었으며, 쥐 및 생쥐와 높은 서열 유사성을 가짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040772-100 Anti-NCKAP1L Antibody, NCK-associated protein 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040772-25 Anti-NCKAP1L Antibody, NCK-associated protein 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NCKAP1L Antibody
Anti-NCKAP1L Antibody
NCK-associated protein 1-like
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human NCKAP1L.
Alternative Gene Names
- HEM1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NCK-associated protein 1-like |
| Target Gene | NCKAP1L |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVD |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000036829 | 97% |
| Mouse | ENSMUSG00000022488 | 96% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.