CacheBy
Atlas Antibodies Anti-NCF4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCF4 Antibody

상품 한눈에 보기

인간 NCF4 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 응용에 적합합니다. Rabbit에서 생산되었으며 IgG 아이소타입입니다. 고순도 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 대해 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036156-100 Anti-NCF4 Antibody, neutrophil cytosolic factor 4, 40kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036156-25 Anti-NCF4 Antibody, neutrophil cytosolic factor 4, 40kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCF4 Antibody

Anti-NCF4 Antibody

Target: Neutrophil cytosolic factor 4 (40 kDa)
Type: Polyclonal Antibody against Human NCF4


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against human neutrophil cytosolic factor 4 (NCF4).
Alternative gene names: p40phox, SH3PXD4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Neutrophil cytosolic factor 4, 40 kDa
Target Gene NCF4
Alternative Names p40phox, SH3PXD4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (97%), Mouse (95%)

Antigen Sequence:
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRY


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.