
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NASP Antibody
상품 한눈에 보기
Human NASP 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. 유전자 및 오쏘고날 검증을 통해 신뢰성 확보. Affinity purification 방식으로 고순도 확보. 히스톤 결합 단백질 연구에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030518-100 Anti-NASP Antibody, nuclear autoantigenic sperm protein (histone-binding) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030518-25 Anti-NASP Antibody, nuclear autoantigenic sperm protein (histone-binding) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NASP Antibody
Anti-NASP Antibody
Target: nuclear autoantigenic sperm protein (histone-binding)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저발현 조직 간 검증
- WB (Genetic validation): siRNA knockdown을 통한 유전적 검증
- ICC: 세포 내 단백질 검출에 적합
Product Description
- Type: Polyclonal Antibody against Human NASP
- Host: Rabbit
- Isotype: IgG
- Purification Method: Affinity purified using the PrEST antigen as affinity ligand
- Buffer: 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Alternative Gene Names
DKFZp547F162, FLB7527, FLJ31599, FLJ35510, MGC19722, MGC20372, MGC2297, PRO1999
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nuclear autoantigenic sperm protein (histone-binding) |
| Target Gene | NASP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000028693 (100%), Rat ENSRNOG00000016454 (100%) |
| Clonality | Polyclonal |
| Host | Rabbit |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야별 최적 사용 농도 및 조건은 사용자가 직접 결정해야 합니다.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



