Atlas Antibodies Anti-NASP Antibody

상품 한눈에 보기

Human NASP 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 검증됨. siRNA 노크다운을 통한 유전적 검증 완료. Rabbit 유래 IgG, 프레스티 항원으로 친화정제. 다양한 조직에서 핵 내 히스톤 결합 단백질 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028136-100 Anti-NASP Antibody, nuclear autoantigenic sperm protein (histone-binding) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028136-25 Anti-NASP Antibody, nuclear autoantigenic sperm protein (histone-binding) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: nuclear autoantigenic sperm protein (histone-binding)
Type: Polyclonal Antibody against Human NASP

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Genetic validation by siRNA knockdown.
ICC (Immunocytochemistry)

Polyclonal antibody generated in rabbit against human NASP, a nuclear autoantigenic sperm protein involved in histone binding.

DKFZp547F162, FLB7527, FLJ31599, FLJ35510, MGC19722, MGC20372, MGC2297, PRO1999

항목	내용
Target Protein	nuclear autoantigenic sperm protein (histone-binding)
Target Gene	NASP
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHV
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000028693 (100%) Rat ENSRNOG00000016454 (100%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand