CacheBy
Atlas Antibodies Anti-NAPSA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NAPSA Antibody

상품 한눈에 보기

Human NAPSA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 분석에 적합하며 RNA-seq 데이터 기반 정교한 직교 검증을 거쳤습니다. 고순도 Affinity 정제 방식으로 제조되었으며, 40% 글리세롤 PBS 완충액에 보존됩니다. 다양한 조직 발현 비교 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047744-100 Anti-NAPSA Antibody, napsin A aspartic peptidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047744-25 Anti-NAPSA Antibody, napsin A aspartic peptidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NAPSA Antibody

Anti-NAPSA Antibody

Target: napsin A aspartic peptidase


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human NAPSA.

Alternative Gene Names: KAP, Kdap, NAP1, NAPA
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein napsin A aspartic peptidase
Target Gene NAPSA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG

Species Reactivity

항목 내용
Verified Species Human
Mouse Ortholog ENSMUSG00000002204 (84%)
Rat Ortholog ENSRNOG00000019854 (77%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.