
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NAPSA Antibody
상품 한눈에 보기
Human NAPSA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 정량에 적합합니다. RNA-seq 기반 직교 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 제공. 다양한 조직 연구에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA045280-100 Anti-NAPSA Antibody, napsin A aspartic peptidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045280-25 Anti-NAPSA Antibody, napsin A aspartic peptidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NAPSA Antibody
Anti-NAPSA Antibody
Target: napsin A aspartic peptidase
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human NAPSA (napsin A aspartic peptidase).
Alternative Gene Names
KAP, Kdap, NAP1, NAPA
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG
Species Reactivity
- Verified Species: Human
- Interspecies Information:
- Mouse ENSMUSG00000002204 (84%)
- Rat ENSRNOG00000019854 (77%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 실험 조건과 농도는 사용자가 최적화해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



