CacheBy
Atlas Antibodies Anti-NAMPT Antibody
원본

Atlas Antibodies Anti-NAMPT Antibody

상품 한눈에 보기

Human NAMPT 단백질을 표적으로 하는 고품질 폴리클로날 항체입니다. IHC 및 WB 응용에 적합하며, 토끼 IgG 형식으로 제작되었습니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성(인간, 생쥐, 랫드 99%)을 보입니다.

카탈로그번호
HPA047776-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047776-100 Anti-NAMPT Antibody, nicotinamide phosphoribosyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047776-25 Anti-NAMPT Antibody, nicotinamide phosphoribosyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NAMPT Antibody

Anti-NAMPT Antibody

Target Protein: nicotinamide phosphoribosyltransferase (NAMPT)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human NAMPT.

Alternative Gene Names

  • PBEF
  • PBEF1

Open Datasheet

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    QETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGED

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000009754 99%
Mouse ENSMUSG00000020572 99%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.