
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NAIP Antibody
상품 한눈에 보기
Human NAIP 단백질을 인식하는 토끼 폴리클로날 항체로, BIRC1/NLRB1 유전자 타깃. IHC 등 다양한 응용에 적합하며, 고순도의 Affinity Purified 제품으로 높은 특이성과 재현성을 제공.
- 카탈로그번호
- HPA042438-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042438-100 Anti-NAIP Antibody, NLR family, apoptosis inhibitory protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042438-25 Anti-NAIP Antibody, NLR family, apoptosis inhibitory protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NAIP Antibody
Anti-NAIP Antibody
Target Protein: NLR family, apoptosis inhibitory protein
Alternative Gene Names: BIRC1, NLRB1
Recommended Applications
이미지에 표시된 추천 응용 분야: IHC (면역조직화학)
Product Description
Polyclonal antibody against human NAIP protein.
Target Information
- Target Gene: NAIP
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KSGIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQD
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021640 | 70% |
| Rat | ENSRNOG00000033693 | 66% |
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도와 조건은 사용자가 직접 실험을 통해 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



