Atlas Antibodies Anti-NAF1 Antibody

상품 한눈에 보기

인간 NAF1 단백질을 인식하는 토끼 폴리클로나 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤과 PBS 완충액에 보존제 포함. 사람에 대한 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA066090-100 Anti-NAF1 Antibody, nuclear assembly factor 1 ribonucleoprotein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA066090-25 Anti-NAF1 Antibody, nuclear assembly factor 1 ribonucleoprotein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: nuclear assembly factor 1 ribonucleoprotein (NAF1)
Type: Polyclonal Antibody against Human NAF1
Supplier: Atlas Antibodies

Polyclonal antibody raised in rabbit against human NAF1.
Affinity purified using the PrEST antigen as affinity ligand.

Target Protein: nuclear assembly factor 1 ribonucleoprotein
Target Gene: NAF1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

SSCISLPPVLSDGDDDLQVEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIF

Verified Species: Human
Ortholog Identity:
- Rat (ENSRNOG00000026403): 90%
- Mouse (ENSMUSG00000014907): 89%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using PrEST antigen
Storage	Gently mix before use. Determine optimal concentrations and conditions experimentally.