Atlas Antibodies Anti-NAGK Antibody

상품 한눈에 보기

인간 NAGK 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 반응성이 검증되었으며, 보존 용액은 40% glycerol/PBS(pH 7.2)입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035206-100 Anti-NAGK Antibody, N-acetylglucosamine kinase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035206-25 Anti-NAGK Antibody, N-acetylglucosamine kinase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: N-acetylglucosamine kinase (NAGK)
Supplier: Atlas Antibodies

IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot)

Polyclonal Antibody against Human NAGK

항목	내용
Target Protein	N-acetylglucosamine kinase
Target Gene	NAGK
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000013911 (88%), Mouse ENSMUSG00000034744 (87%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.