CacheBy
Atlas Antibodies Anti-NAE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NAE1 Antibody

상품 한눈에 보기

Human NAE1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB에서 독립 항체 검증 완료. APPBP1/ula-1 유전자 대응. PrEST 항원으로 친화 정제되었으며, Human, Mouse, Rat에 반응. 보존용 PBS buffer 및 sodium azide 포함.

카탈로그번호
HPA041178-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041178-100 Anti-NAE1 Antibody, NEDD8 activating enzyme E1 subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041178-25 Anti-NAE1 Antibody, NEDD8 activating enzyme E1 subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NAE1 Antibody

Anti-NAE1 Antibody

NEDD8 activating enzyme E1 subunit 1 (NAE1)
Polyclonal Antibody against Human NAE1


  • IHC (Immunohistochemistry): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody raised in rabbit against human NEDD8 activating enzyme E1 subunit 1 (NAE1).


Alternative Gene Names

APPBP1, ula-1


Target Information

항목 내용
Target Protein NEDD8 activating enzyme E1 subunit 1
Target Gene NAE1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDE
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000033133 (96%), Mouse ENSMUSG00000031878 (96%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.