
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NAE1 Antibody
상품 한눈에 보기
Human NAE1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB에서 독립 항체 검증 완료. APPBP1/ula-1 유전자 대응. PrEST 항원으로 친화 정제되었으며, Human, Mouse, Rat에 반응. 보존용 PBS buffer 및 sodium azide 포함.
- 카탈로그번호
- HPA041178-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041178-100 Anti-NAE1 Antibody, NEDD8 activating enzyme E1 subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041178-25 Anti-NAE1 Antibody, NEDD8 activating enzyme E1 subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NAE1 Antibody
Anti-NAE1 Antibody
NEDD8 activating enzyme E1 subunit 1 (NAE1)
Polyclonal Antibody against Human NAE1
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human NEDD8 activating enzyme E1 subunit 1 (NAE1).
Alternative Gene Names
APPBP1, ula-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NEDD8 activating enzyme E1 subunit 1 |
| Target Gene | NAE1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDE |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000033133 (96%), Mouse ENSMUSG00000031878 (96%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



