Atlas Antibodies Anti-NADK2 Antibody

상품 한눈에 보기

인간 NADK2 단백질을 표적으로 하는 토끼 폴리클로나 항체. IHC 및 WB에서 검증된 고품질 항체로, PrEST 항원을 이용해 친화 정제됨. NADK2의 미토콘드리아 발현 연구에 적합하며 RNA-seq 및 독립 항체 비교로 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061492-100 Anti-NADK2 Antibody, NAD kinase 2, mitochondrial 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061492-25 Anti-NADK2 Antibody, NAD kinase 2, mitochondrial 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: NAD kinase 2, mitochondrial
Supplier: Atlas Antibodies

Orthogonal validation: Protein expression validated using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Independent antibody validation: Protein expression validated in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human NADK2.

C5orf33, FLJ30596, MNADK, NADKD1

항목	내용
Target Protein	NAD kinase 2, mitochondrial
Target Gene	NADK2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVLLE
Verified Species Reactivity	Human
Interspecies Identity	Rat (98%), Mouse (97%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.