CacheBy
Atlas Antibodies Anti-NAA40 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NAA40 Antibody

상품 한눈에 보기

Human NAA40 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 사용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. PBS와 글리세롤 버퍼에 보존되어 안정적입니다.

카탈로그번호
HPA037816-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037816-100 Anti-NAA40 Antibody, N(alpha)-acetyltransferase 40, NatD catalytic subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037816-25 Anti-NAA40 Antibody, N(alpha)-acetyltransferase 40, NatD catalytic subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NAA40 Antibody

Anti-NAA40 Antibody

Target Information

  • Protein: N(alpha)-acetyltransferase 40, NatD catalytic subunit
  • Gene: NAA40
  • Alternative Gene Names: FLJ13848, NAT11

Product Description

Polyclonal antibody against human NAA40. Suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
  • Antigen Sequence:
    DLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000024764 99%
Rat ENSRNOG00000021179 97%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Reference

Open Datasheet (PDF)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.