
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NAA40 Antibody
상품 한눈에 보기
Human NAA40 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 사용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. PBS와 글리세롤 버퍼에 보존되어 안정적입니다.
- 카탈로그번호
- HPA037816-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037816-100 Anti-NAA40 Antibody, N(alpha)-acetyltransferase 40, NatD catalytic subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037816-25 Anti-NAA40 Antibody, N(alpha)-acetyltransferase 40, NatD catalytic subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NAA40 Antibody
Anti-NAA40 Antibody
Target Information
- Protein: N(alpha)-acetyltransferase 40, NatD catalytic subunit
- Gene: NAA40
- Alternative Gene Names: FLJ13848, NAT11
Product Description
Polyclonal antibody against human NAA40. Suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
DLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024764 | 99% |
| Rat | ENSRNOG00000021179 | 97% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Reference
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



